HomeAbout UsBasketContact UsDelivery / Returns
SilverOther MetalwareAntiquesDecorative CollectablesPorcelain / Glass / Ceramics
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
HomeAbout UsBasketContact UsDelivery / Returns
0 items
SilverOther MetalwareAntiquesDecorative CollectablesPorcelain / Glass / Ceramics
Silver Mustard Spoon London Hallmark 1836/37 26g
Silver Mustard Spoon London Hallmark 1836/37 26gSilver Mustard Spoon London Hallmark 1836/37 26gSilver Mustard Spoon London Hallmark 1836/37 26gSilver Mustard Spoon London Hallmark 1836/37 26gSilver Mustard Spoon London Hallmark 1836/37 26gSilver Mustard Spoon London Hallmark 1836/37 26g
Silver Mustard Spoon London Hallmark 1836/37 26g
£26.00
Silver Mustard Spoon Hallmarked London 1836/37 Weight 26g Measures 11.5cm
£26.00 inc. tax
Units in Stock
1
Add to Cart
Details
Silver Mustard Spoon Hallmarked London 1836/37 Weight 26g Measures 11.5cm
Product Code: wIITz5
Product Condition: Used
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i