GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Original 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeve
Original 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeveOriginal 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeveOriginal 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeveOriginal 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeveOriginal 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeveOriginal 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeve
Original 1950s “The Unique Series Of Draughtmens Scales” All 4 card rulers and original sleeve
£12.99 inc. tax
Original 1950s The Unique Series Of Draughtmens Scales. All 4 original card rules and paper sleeve. Presented with complements and thanks by The Technical Supply Co, Carden Avenue, Brighton.
£12.99 inc. tax
Units in Stock
1
Add to Cart
Product Code: xtpQca
Product Condition: Used
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i