GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
1940s Vintage A.Jones and Sons Bootmakers Ltd Aluminium Shoe Stretcher
1940s Vintage A.Jones and Sons Bootmakers Ltd Aluminium Shoe Stretcher1940s Vintage A.Jones and Sons Bootmakers Ltd Aluminium Shoe Stretcher1940s Vintage A.Jones and Sons Bootmakers Ltd Aluminium Shoe Stretcher1940s Vintage A.Jones and Sons Bootmakers Ltd Aluminium Shoe Stretcher
1940s Vintage A.Jones and Sons Bootmakers Ltd Aluminium Shoe Stretcher
£14.99 inc. tax
1940s Vintage A.Jones and Sons Bootmakers Ltd Original Aluminium Shoe / Boot Stretcher. (Left) Superb display piece. Plenty of patina and charm visible. (Please study photos)
£14.99 inc. tax
Units in Stock
1
Add to Cart
Product Code: I9EC0R
Product Condition: Used
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i