GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
The Regnas Aseptic Nasal Douche Sanger’s Ltd Boxed Original No breaks
The Regnas Aseptic Nasal Douche Sanger’s Ltd Boxed Original No breaksThe Regnas Aseptic Nasal Douche Sanger’s Ltd Boxed Original No breaksThe Regnas Aseptic Nasal Douche Sanger’s Ltd Boxed Original No breaksThe Regnas Aseptic Nasal Douche Sanger’s Ltd Boxed Original No breaksThe Regnas Aseptic Nasal Douche Sanger’s Ltd Boxed Original No breaks
The Regnas Aseptic Nasal Douche Sanger’s Ltd Boxed Original No breaks
£18.99 inc. tax
The Regmas No 104 Aseptic Nasal Douche By Sangers Ltd England Fantastic original item. Glass douche is in excellent condition. No breaks or cracks. Box is good condition as shown
£18.99 inc. tax
Units in Stock
1
Add to Cart
Product Code: 8ZE0xh
Product Condition: Used
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i